SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7TJR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7TJR3
Domain Number - Region: 59-81
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0119
Family Proteinase A inhibitor IA3 0.0056
Further Details:      
 
Domain Number - Region: 9-64
Classification Level Classification E-value
Superfamily Tropomyosin 0.0142
Family Tropomyosin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7TJR3
Sequence length 93
Comment (tr|A7TJR3|A7TJR3_VANPO) Uncharacterized protein {ECO:0000313|EMBL:EDO17492.1} KW=Complete proteome; Reference proteome OX=436907 OS=(Kluyveromyces polysporus). GN=Kpol_1058p29 OC=Vanderwaltozyma.
Sequence
MSEDKSYLEQSKDYVTHKKDELSHKFHGEDKKVDKPDENIDKPESNLESQKPRSQALKED
VNEYYQSAKDSLSGAAKYVSSHIGGGGSGGTSN
Download sequence
Identical sequences A7TJR3
436907.A7TJR3 XP_001645350.1.22633 tr|A7TJR3|A7TJR3_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]