SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8B1Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8B1Z9
Domain Number 1 Region: 908-960,1010-1214
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-39
Family Ankyrin repeat 0.0008
Further Details:      
 
Domain Number 2 Region: 394-488,521-551,657-686,794-854
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.74e-29
Family Ankyrin repeat 0.0058
Further Details:      
 
Domain Number 3 Region: 721-890
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000693
Family Pseudo ankyrin repeat 0.0065
Further Details:      
 
Domain Number 4 Region: 123-343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000114
Family Protein kinases, catalytic subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8B1Z9
Sequence length 1287
Comment (tr|A8B1Z9|A8B1Z9_GIAIC) Protein 21.1 {ECO:0000313|EMBL:EDO82198.1} KW=Complete proteome; Reference proteome OX=184922 OS=lamblia). GN=GL50803_6342 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MPPKKTTSTKDSSRAGSKQASSGQSNAKGASKGKGGARAPSKLQKTKKSGSVKNISDKDQ
LPPSEAHVPKVFAPFEPPHPYKLIPDSTETRGLQGKHLCTHPSSSTPHVFVSFCIEGLEE
GPKRDLKQRYNNLKLFRHENLRTYDHFYDGFLTSTGAVSDYLAASYEPCEPKGHTLKEIC
SMYQNKGQLICESTLWDIAAQLFNLLAVMHSPLDLEIKSGARHSFGAGENHQSLPLPHGN
LSTSTIVCDYSSRSDYELTVGLPLLSGYRNLEVGVSDGEPESLILITPEDDIRDAGIILH
ELATFSEAGNIPVTYSSNFQSFLRSLTSKDPAKPLPSASEILLLREVQGIIYRRTAPSEQ
KLHELLSKTSLKVDTHTEPDVEQATLLDAPVSPDEDGNTPLHLAVQEASLNDLSKLKGYA
GRRNKKGKTALMIAVEMDAIDAVRELAPLESNCFLLDGTTALSLALELEHLECAAILLKY
EGIDNRAPNIDGNGVTNLMRAAENNDLVGVWSWLPRQCKYADNQGQTAFMRAAAIGNLKL
CKLLMQSEAGMRDINGRTALMHYAITGGSVSLDEYEAYHLAYPSTIDIPSDMSIMCSQSS
TRSFPPPADNTLRSTTALSTSALSTSTDLRRLKRSRFHQEVSVNSELLQLLCSLEGNMTD
KNGRNALYLAIAVNNMETALALVPYEGPEPVYVRESSSKDLQLGHSQDGTVSTDTSTFHL
CSPDKYPSGFTDLMDAVLENDVYRAFCFMQTQSKRFDSSGFSALMYAAYNNRPMLCRLLA
IEEAKLQAYVHTNPNNFYSCNKTALMVAAEAGHIECVRILAPYEACLTDSEDKTALMYAA
SNGYEEVVMELLQRESGMHAGRFNATSYAIMNGHYKIANILLASEKDANDNYVRAAEQLR
SASDSLRTTPLMLAAKTGDISSVFNFRNQYIKMVDARGMTALLYACEFGCRYCVHLLKDE
AHIYRKSDGLTPRALAEEHHLVDCYDDLPPITVRDNRGNTQLHRAVLENNSTDLQRYCHL
ARELNSAGLTSLMLAAANNNVEAASLLVNREGGIVAKKYKVTNLLWTEVTAMMIAAALGH
HEIVQKLVCKEAKMCEKTEGRTALMAAAALGRVDVVRVLSAHESHIQKHDGWSALMYAAA
YGYGDCVEYLLDEVRLTADDGWTALMCAAKNGHSDIVRQLIEYEKGMLKSKKYPALYYAI
VSGHIDCVKLLLPHEYSFCKAHIINEIRTRKSVPQETLAELSNLLRSQELSAMCDQSGSN
QNEDIDRIITVDGADDPDIMNTEASEK
Download sequence
Identical sequences A8B1Z9
gi|157437990|gb|EDO82198.1| gi|159119308|ref|XP_001709872.1| XP_001709872.1.56740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]