SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8B6S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8B6S0
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 1.83e-19
Family Nucleolar RNA-binding protein Nop10-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8B6S0
Sequence length 63
Comment (tr|A8B6S0|A8B6S0_GIAIC) Ribosome biogenesis protein Nop10 {ECO:0000313|EMBL:EDO81367.1} KW=Complete proteome; Reference proteome OX=184922 OS=lamblia). GN=GL50803_8242 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MILCKCPSCDAYTLEEACPHCGVVTRTAHPAKFSPDDKYSEQRVRFLSRFPGSSLMTSPA
FTF
Download sequence
Identical sequences A8B6S0
XP_001709041.1.56740 gi|157437156|gb|EDO81367.1| gi|159117643|ref|XP_001709041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]