SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8GNY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8GNY8
Domain Number 1 Region: 5-125
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000471
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8GNY8
Sequence length 143
Comment (tr|A8GNY8|A8GNY8_RICAH) Ankyrin repeat {ECO:0000313|EMBL:ABV75113.1} KW=Complete proteome OX=293614 OS=Rickettsia akari (strain Hartford). GN=A1C_04205 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MRNNDVDQDLSLISKLIEANQCQKFNGDLRNRDPEETYYEVYYPFLSVAVLKRNLTMLTI
LLEYDFKPHAISSALNPETTPLIEASRCGRVDMVLKLTSILNKDELNYYDHDIKNSALYY
AIQNNLRFATFSISILLLPKNTL
Download sequence
Identical sequences A8GNY8
293614.A1C_04205 gi|157825901|ref|YP_001493621.1| WP_012149743.1.98304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]