SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8HNY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8HNY5
Domain Number - Region: 422-471
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00798
Family Pseudo ankyrin repeat 0.014
Further Details:      
 
Domain Number - Region: 423-480,544-562,684-773
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0124
Family Ankyrin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8HNY5
Sequence length 979
Comment (tr|A8HNY5|A8HNY5_CHLRE) Predicted protein {ECO:0000313|EMBL:EDP09572.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_190215 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MSGGLVATTVYADAEPPLDEASLPALHQELQWQRNDVRIFAHAAAETQVAIKDALAHKFN
TARSGAADSIAAGVNDPGFLEVFPRVASRPPKLLQELEAILVDRLRANDKAASMTVLGSA
RERDPKLSANLSLDGHRQVMSAFIAGFSTYAPLLSRIQAEFDRALNEGVRSAQENVEMRY
QMASNELARERATAEVRGQVLAEDLSFRAAALSKLQELRERAVRAEKKKLLAEKDLRDAQ
AEEARMRALVESLRGTNNKLQELLIEEDRWAAKPLSGHLVGMPIGPLTKADEEFLEQELG
GMDTLAVTPSAAAAGAASAFKSSMSLARNNSAACLKGSYNVITIYTCKPSRFLRPRLEVA
HASSWPGHSFAHYWGRPKPWDKLTLRRRLRLLCLAASSFHPASLHVALQFSGVALRPEVA
EAASAAGDLQAVQRLVAEGCELSLEAVKLAAACGHLSVLQWIWSGAEPQLRLRSAFGWEA
AGSHQAVAEAACAGGQGVVLTWLEAQNVEAVAVPPLAGAAGEAMPPAAAATDFEPRGWGF
AGLLNAAACYGQYEIVERLYMQEVERLGMPHLADLLACRLRVAAMCGTQEELAWRYQDLA
GIEHVHLGKNLLSDLFACALCALDSHWRAKAEWLVDCWETEFDMDPQLLEEILTLGFFKF
KHRAGSTNRIVPEQPDVFERFRVGAARVDLADRGGSWHVHAAAVAVRADNVPLLQAVLED
WSPTAASEAIGSEDFRALLDDAVLSDDPRPVVLFGTSHLLLAAKEGCMRMLEFMFPWFPA
IRAHDRHDQQLRGLGERGLPVDVAAVAAGGSVQAVEWAVWAQLQQELTGRHTAPTRGIRR
PGLSMSVSTFTTPGHAWHVAATCGNLATAARMLYHAWTYENAGSACRQPAGFLARPRSVR
YFNGADGRCRAVNCLRLWASMLDQPAPQPPRYALPRLTAEQWAELVSYLDSPQRRPPQLQ
PHQLAWARAVQAPDTVVHV
Download sequence
Identical sequences A8HNY5
XP_001689834.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]