SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8HZR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8HZR6
Domain Number - Region: 473-529
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0209
Family Pseudo ankyrin repeat 0.036
Further Details:      
 
Domain Number - Region: 12-73
Classification Level Classification E-value
Superfamily F-box domain 0.0523
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8HZR6
Sequence length 668
Comment (tr|A8HZR6|A8HZR6_CHLRE) Predicted protein {ECO:0000313|EMBL:EDP07996.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_187635 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MPGARVLAAAAAAARSGWHKLPLDVLGNICARISQNDVVSLSLADRATRTAVKDGLGYPG
LLRLSLPVPPAFFSRCWAAPGAFSRLPEPKRKRLLCLLATSGSLANLRFAGERCGLERPL
TLGEVLCAAAEAGHVALCRELVFQRDAAQEWSEANSLSDGVSQTRMLVAAAASGHLYQFA
WLVRRLGLRRRGLLEAGTADLSNQPPTGGLLLLRNVLVAAAEAGHAAFVEALLPPCGAAA
SLLYPLEEGRRRDEVWQRQWQQPTASLIPELLPELILAAVQAAAGLQLQQGRRGSQHGPA
CGCEGCALRRRPEERPSRSKTSFRPAGAAGAGAAGPRPRLESGQEALRRVLWLESRGYRA
MPEPQKGGGAAKGHSGGSSAAGCLAVNQAALAGNLPVLAFFMGPPHSRSRRPDEKKQPPR
PDAPTVEAQALSPGRCPPGLWLSLFAVALTSAQAEAAHWVLSVLLDGDHWFYEELMRLAV
QSGCVPLARLMREAAAAFPWDREAVWTAAARCGSGDMLLWLQEAGCDMEKSAQPLVAAAV
NADMATLQRLRTAPLHYPIDWRMAGGTLTDIHNDDPHLRLRLVAEAEAAGPEAELMLQYG
LHHGLFGDWDDMHGGCGRKMWRGLKRLCCGGRRGRRRRVVRKCLSCMETSVLVCLLVCCY
PCIQRQLD
Download sequence
Identical sequences A8HZR6
XP_001698503.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]