SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8I0N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8I0N5
Domain Number 1 Region: 103-178
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000275
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8I0N5
Sequence length 780
Comment (tr|A8I0N5|A8I0N5_CHLRE) Predicted protein {ECO:0000313|EMBL:EDP07872.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_143093 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MQSDQQQADWSWLTGDLLRRIAEELDPSEVASSLKLLNKFSATALGGTYRYIVLGRKVVW
RPASPPVPMQLVARQPWPRGAFPRHWGRPEPWARLTLPQRRLVLQLAASSGDPHSLTAAL
ENCGCSVTYTALVAAAVVGDSEACQRLLHDEGCSCPDEVFEAAAYSGSLDVLRVLRGLWP
AHAAEAASLCDAVAVAAASFGHANVLDWLEDEFGGGPSILNEQNASRIGDGPWPVRDVDT
LVSEALGCPAADWAERVRWLVGFWQQRLQQVREAREARQAAQAQAAQQAAQQAELQAAQQ
AAQQAAQQAAQQQTEGPQLPQPPPLPPQGPQPPEPHQLGPQDQAAPAQEMAEDAAADEEE
MEEETGCTEALSYTASEAVAEPVPVGWDPQLFKEMLDFAVRCGQAPMTKMLLTAARVGQP
PSTHPMSLHRGFVADALRRGFPHVAAVLMEALVAQEDAVAAAAREQAAAEQATAAAAAAA
AAAAAAVAAPTAPAGPEGAPSAAVAAADAALGVSMAQAGVSGGAIDGSGGNSGASGAAAA
AARRPRFSLFWTKVFGAAACQGMELPYLWLMHERWGAAVDIRAVADGGSVEALAWAAGVL
QAQEAAEVACGLGEGSAEGASADAEDGDSVHGEVVFRKKAQILRDLAAPLTERDVWTLAA
SGNFAACDWTMETTRIGHGTMAASSGGSAAPHEFVGLYASSPALRYWLQLLERQQQLMAL
QPDEQQRLAAGAAAGALAGAMVGAIAGAVAGTAPTAADAATDVRTGTRAGVSAGCAAAAA
Download sequence
Identical sequences A8I0N5
XP_001698379.1.80978 jgi|Chlre4|143093|Chlre2_kg.scaffold_4000216 3055.JGI143093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]