SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8IEA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8IEA7
Domain Number 1 Region: 126-209
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000123
Family Pseudo ankyrin repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8IEA7
Sequence length 593
Comment (tr|A8IEA7|A8IEA7_CHLRE) Predicted protein {ECO:0000313|EMBL:EDP05976.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_143907 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MAGAEDQLGLLNPGLLRNIAGALHPNEVASSFKFANKEVLGCLRDDYRTFNLARKPSRWC
SSIVRGVGSPPSLAEQPWPGHDFVAHWGRPEPWRALNRRQRHRLLCLAASSLHPPSLDAA
LAHCGTVVKADALVSAAAVGELEACRRLLVEEGCHWDTEPVWAAAAMNGHVAVCRWLGEI
GMYGGEVASTKRFVVKACCFSGQREVLAYMQTEVGRGWGGEPLPAELATAAAEGGQVELL
GELLAAAAVTGAMQCCEVLAGVAYGCPSEVLQHYYGQWGTEAAAEAQHRQALLLRAATSP
TGDWAAKCDWLLLRMLLAMMGRELSRPPAPPQVLATAAAAAGQVPVLRILRAEGVAFSYV
QNLKAALELPLPFNELLVNERPFECLPALRYLLMEGGGLEEAEATEAAAAAEDGEEEEES
AVDWSAVLRHAAQRGSDLALLRHLHEQHGAAINFEELVAGGSEEQLEWALGVLGPAGVSS
QASGVALFRSALVSGNWAAAEWLRSRGLAVDPDDQQQLQQLFCSLAAEQDTPLHIPALWW
LLQRYSLQWTPECRDALDVCQEIAWAGGWPVAAGHSQWMQEMMQMTVKALAAL
Download sequence
Identical sequences A8IEA7
jgi|Chlre4|143907|Chlre2_kg.scaffold_9000138 XP_001703294.1.80978 3055.JGI143907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]