SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8IL93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8IL93
Domain Number 1 Region: 187-315
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000262
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8IL93
Sequence length 392
Comment (tr|A8IL93|A8IL93_CHLRE) Predicted protein {ECO:0000313|EMBL:EDP05540.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_144729 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MVHGGDGAIETWQPQQALHGGPPPSRSLLMDPVLVPYMQRSAIVAAAAGSAVDWDLKVWV
RAVAVRRGYGVSYLATRAATLALIEASKEEEAAAAAAAAAAAAAAALRELSGRPLEAGVA
GVGGAGAGVARTGAGRVSGSGEAAGEVGVPVDKLAVLEFVLRAQARVTDDTANMAAAAGL
LEVLQLFDGSLNVRLNADALMLEAARAGQLHVVKWLAARHNGECQLSYAVLAAAAEGGAV
EVAAWLHQQGLEPKSEWADRDSRAVNDAFPVRAAAAGGSAAALRWLVEKGYPVTDDGSPY
VLAIRNGDVVTLRNLRALGCRWDPHSPQLAAAARSAQLTSGCAAVVLWLEEQGLDLESVE
RAARKRAKKRAAAMAAARARDVTGGIQASQGR
Download sequence
Identical sequences A8IL93
3055.JGI144729 jgi|Chlre4|144729|Chlre2_kg.scaffold_11000274 XP_001691094.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]