SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8IZG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8IZG1
Domain Number 1 Region: 103-278
Classification Level Classification E-value
Superfamily TPR-like 6.5e-20
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Weak hits

Sequence:  A8IZG1
Domain Number - Region: 360-423
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0109
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8IZG1
Sequence length 1002
Comment (tr|A8IZG1|A8IZG1_CHLRE) Predicted protein {ECO:0000313|EMBL:EDP02712.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_173906 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MVARVKASKRTFKEKLHNLIAEAEAAEAQAYRETQLADKKSLCIQLLVEGRPQAFVDFFS
LTHNRMAGGEVGPDGQPAAAAAAAGDDVPQEALGLLRSELLKADNALRTGDTQAVYASYK
NLAKYFAQIGRLHKAEFFFRRCLRLSQDTQWLAGELEANLALGVVYEELQETEAAIACYE
RRLSLASDNQLALESDTAYQNLTTVYLRQAEVQESTGQVDDAIASYNKCLSAAERSGDNA
TAAKANYRIGMLYAGGRRHPEAVHYLRAFIDLAPHMEDKVGGCVYRVVTVGQELKTPIGW
MANRPLRVAGEAWPGDAFVKHWGRPEPWRALTQKRRSLLLCLAASSHHAASLEAALTHCG
VGLASEVLETAAAAGDLAACQRLVQEGCEGSYRSVQFAAYFGHLHVLQWAWAAGPHEARS
LLWQALFGDEPFPLITVATWASHWVPEDHYWILFNIPGAICRLRRDVSLSKVSVPPSKLL
PPPPPPSKLLRGDASASRHVAEGSSPEVLQRFYDAWVPRVTRLDSDKERAQLLSQAVSST
SGGWQAKVEFLLSRWAAGGTAGQQAVARVMRAFGQELRSWRREVWASHDYAQRWRFLVAQ
GLPDGWQLQAVRQAAVSGNCTALAELLNAWAAPKTLPAPDPRWHHGGAHEQQPSRAAGPW
PGPSLVQELGQMAVREGQLPVLHMLWQRYGPNVVQLGVKDIATSRAGSLETAWYLARMLE
PVEGPRDVRPWREEADEVTAGDGEWDEALSSCVYAGADESLLGMLVERYRARMDLPQMVK
YSSVQTLDWALGVARAQNEERVWLLKIQQERAEYWHGLPYEITTTFTMRQLWLLASRGNL
AAASWLLDCGLLSPPTSLLPHPADFFRPGYDYVDEWEEGSDGFGGSSSSMWPDHTLEAPS
RRVHAMGYLRLWVTHNMAVTGTAAASSAAGTASGVEAVAGGEGAAGGSSVSSSSSDHAAL
VQQWDRLVDFASTFQDPPLLPHQLEWLRRRRLEVVAGWAAAI
Download sequence
Identical sequences A8IZG1
XP_001694279.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]