SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8J9X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8J9X4
Domain Number 1 Region: 265-339,372-384
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000602
Family Pseudo ankyrin repeat 0.017
Further Details:      
 
Weak hits

Sequence:  A8J9X4
Domain Number - Region: 270-321,441-532
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0373
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8J9X4
Sequence length 952
Comment (tr|A8J9X4|A8J9X4_CHLRE) Predicted protein {ECO:0000313|EMBL:EDO99283.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_177318 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MAASDPAARDWALPEPLRRTVQLSCYGDLSPQFRRANLEVHRASLAAAGLWSEAAMLRRL
LYKNTHQHRGGHFMRYLLERPLHAAAGQLGAQLALTYFVPLATTAAAMLARIKVLSLQLA
LDCVKAYNDLAEASEVPTAPVPAASPIVLSYATRSGFVLGRTGAATFKLASKATAASLRE
QYYTVELAREPRRQFSVVLHSPTDSHLYEPALAHPAWPGPDFVAHWGRPEPWRSLNRRER
HRLLCLAASCHHVPSLDAALAHCGTVIKADALASAAAAGDLQTCQRLLLGEGCHWQGNVV
VTAAARAGHIHMCDWLARLQASEVGGTRNLRHIALAACFCGQRAVFEWARAECERIGPVV
REAVKWATAAAEGGHIGLLQELVEARATDMEARDQPQTLGGVAYGCSLEVLQVYYARWGA
ECAAGSRHKRQLLLRALASPTPDWAAKCDWLLLQWAAVTGWPGAEERELGGGTFEGWMHA
AWQPDYLQRLLLLAGHGFGLCLNAAEAAAAAGNVGVLRLLQERGFELSAQHLEEALAFTS
SDFNSPTETEGQGLPSVRYLSTLELPDNALRGAVVSLAAVAQGGGEDALEWALRQLPGAA
AGLLPTPLSSRDFTTVLSAGNWAAADWLLARGLAPTRQEQLQRLFAALAPDMGEAVLVCG
IPALRWIVARSGLRWTAKCRAMLVKLRVKLTQGELSVFVAPGQARWLEEMVGVLRLLRER
GFELSAQHLEEALAFTSSDFNSPTETEGQGLPSRGAVVSLAAVAQGGGEDALEWALRQLP
GAAAGLLPTPLSSRDFTTVLSAGNWAAADWLLARGLAPTRQEQLQRLFAALAPDMGEAVL
VCGIPALRWIVARSGLRWTAKCRAMLVKLRVKLTQGELSVFVAPGQARWLEEMVAAADVA
LLATAYLSRALTPSLPGDGAANDSAMGGRVAAAQKNTATAKITNQDHHKRIT
Download sequence
Identical sequences A8J9X4
XP_001698783.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]