SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8JDU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8JDU4
Domain Number 1 Region: 95-201
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000085
Family Pseudo ankyrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  A8JDU4
Domain Number - Region: 292-336
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0759
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8JDU4
Sequence length 528
Comment (tr|A8JDU4|A8JDU4_CHLRE) Predicted protein {ECO:0000313|EMBL:EDO97952.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_178863 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MASARTIMWLRLTPELKQHIASYLPENDAAANLKLADRDTAAALRGLYCNITLSEQQESE
WVPRVCKPWPSADFVAHWGRPEPWRALTLPQRQRLLCLAASSGHAPSLDAAIANCGCMLT
PNALTAAAAAGNLAGCERLLASHCECSAAARNAAVMAGHLQLLQLLLESAPKYLIVQTLD
ELARTACMYGQAHILTWLRRARGFKPHFYHAMAAARGGHVRLFEELVPDRLVMDCGLRVP
VVEAAAGDATGQAVPEEQRPVQGDRVGDSSDAAAQEGPALVLERWRVLDALVLGCPVEVV
QYLLGAWGPVVAGQVLGGKEVVVAGPTGAVLWRGERGREVALAAAVHHPEILLRFRHAHA
DGLASRHSDAVRGVLQRGDAAALAYLWDVCGVAARLGDTWDPLVVRDAYLGWGHVAVLQL
LQERGYGFTAADVEREAWGQGTSTGMCCGFDMGMGLAAVACGGSEETLEWAVAELAAERG
CRPRALRGDAAVSLMDGPNAATRDWLLREGLLRTAGPWEEAASEEEGE
Download sequence
Identical sequences A8JDU4
XP_001700623.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]