SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8NHG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8NHG0
Domain Number - Region: 39-69
Classification Level Classification E-value
Superfamily Stathmin 0.0327
Family Stathmin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8NHG0
Sequence length 90
Comment (tr|A8NHG0|A8NHG0_COPC7) Uncharacterized protein {ECO:0000313|EMBL:EAU88044.2} KW=Complete proteome; Reference proteome OX=240176 OS=9003) (Inky cap fungus) (Hormographiella aspergillata). GN=CC1G_10817 OC=Coprinopsis.
Sequence
MSSFPWVRFTGMTAVFMGVGYILMKVTTPTEEQLYNQMAPDLRRKVDAAREARLAREAEM
KKQVNAQISNDENPEAAKPIWASRPGDPKQ
Download sequence
Identical sequences A8NHG0
XP_001833752.2.59657 CC1G_10817T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]