SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8NPS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8NPS6
Domain Number 1 Region: 10-149
Classification Level Classification E-value
Superfamily MTH1598-like 1.1e-39
Family MTH1598-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8NPS6
Sequence length 149
Comment (tr|A8NPS6|A8NPS6_BRUMA) Bm2736; Putative uncharacterized protein {ECO:0000313|WBParaSite:Bm2736} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm1_22405 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MADAPITAAVKYEYLDHTADVQLHGWGDTLEEAMEQTLISMYGYMTEISMVSAEYSFDLF
ASGIDMVSLMARLLDEALFAFSTEPFFIGRVAKVIKLDREKFEVQMRCWGESFDLSRHPQ
GTEIKAVTYSNMQVNESLDKTDIYVIVDI
Download sequence
Identical sequences A8NPS6
Bm1_07225 Bm1_22405 XP_001892914.1.25112 XP_001895937.1.25112 Bm2736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]