SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8PYD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8PYD2
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily RNA polymerase subunit RPB10 2.49e-26
Family RNA polymerase subunit RPB10 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8PYD2
Sequence length 83
Comment (tr|A8PYD2|A8PYD2_MALGO) Uncharacterized protein {ECO:0000313|EMBL:EDP44242.1} KW=Complete proteome; Reference proteome OX=425265 OS=(Dandruff-associated fungus). GN=MGL_1639 OC=Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
Sequence
MIIPVRCFSCGKVIGDKWDAYLALLIEGRTEGEALTELQLHRYCCRRMVLTHVDLIERLL
HYNNVAPLCFYHAHFRFPSPPSV
Download sequence
Identical sequences A8PYD2
gi|159105356|gb|EDP44242.1| gi|164660666|ref|XP_001731456.1| XP_001731456.1.82384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]