SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8RBZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8RBZ5
Domain Number - Region: 41-86
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 0.0484
Family Dimerization motif of sir4 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8RBZ5
Sequence length 188
Comment (tr|A8RBZ5|A8RBZ5_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EDP11304.1} KW=Complete proteome OX=428127 OS=Absiella dolichum DSM 3991. GN=EUBDOL_01224 OC=Erysipelotrichaceae; Absiella.
Sequence
MEFLKELLGDDLYSQVEAKLKDNKDVKLANLASGEYVSKAKYDDKEAELVKANNTITSLQ
DAASKFEGTDIENLKTQITDNKAKYDADIAKLQEDMKKRDAIDAWLDAHPTKHRALIRSQ
FDYSKLQIENDTVKGIDEIGKTLTESYADMFESTNDGGNGGMPHGKPPVEKDPSKMSMEE
YKAWRSKQ
Download sequence
Identical sequences A8RBZ5
WP_004799557.1.42197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]