SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8SML9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8SML9
Domain Number - Region: 225-285
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00248
Family Pseudo ankyrin repeat 0.034
Further Details:      
 
Domain Number - Region: 51-83
Classification Level Classification E-value
Superfamily PX domain 0.0981
Family PX domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8SML9
Sequence length 344
Comment (tr|A8SML9|A8SML9_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EDP23564.1} KW=Complete proteome OX=411465 OS=Parvimonas micra ATCC 33270. GN=PEPMIC_01369 OC=Parvimonas.
Sequence
MFENYSFGDLLSNIYKKRILNLIAFLLLSIALVCPLVLQTINKKTITKEGVQYSTYVAYK
ITAPESDNINALYSRRGYSDFYEKLLVSNLNGAYLFNDVSDKDLSKMAKELDTSAVTLKN
SNADYWDKKVVVNYISTNLGVSAKILTPSKAVNDVIEKKFDELINKYKSVYKNVTIEKVE
SNYSKELSSKENVNTGYSMKKLLVKVFAIEVALIILVAIMNFVMYIFNPTINREGDYRKY
NIKFVQEIKNNNDLLEVLKYKINNENIEELSILSSNSKIIDKLNDLNIDKVNIVKTNDLS
NIMNLKNVILVEEYGITRYSAFEKLLQNIKNYEKNIIGVLSYKL
Download sequence
Identical sequences A0A0B4S1G0 A8SML9
WP_004833299.1.38655 WP_004833299.1.81251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]