SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8UK98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8UK98
Domain Number 1 Region: 26-173
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.00000942
Family PA0094-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8UK98
Sequence length 175
Comment (tr|A8UK98|A8UK98_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:EDP71541.1} KW=Complete proteome; Reference proteome OX=391603 OS=Flavobacteriales bacterium ALC-1. GN=FBALC1_03617 OC=Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales.
Sequence
MKTKFLTLLVLLSSSIMLAQDEWQTLEQDNYSISYPKDWVSSDEKPQPSVLFLLKAPENS
QKEDLFRESINLVSEPLGGQTLSIEDYVKISLDQIMAQIPSAEIKSNKETKLGDEDAREV
VWSADFGNGMVLQFKQVYIINNGTAYVLTFSSTTSEYDAYDEVVNKTLNSFKFSI
Download sequence
Identical sequences A8UK98
WP_008270640.1.13341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]