SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8WM27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8WM27
Domain Number - Region: 112-144
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0602
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8WM27
Sequence length 251
Comment (tr|A8WM27|A8WM27_CAEBR) Protein CBG25084 {ECO:0000313|EMBL:CAP21529.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG25084 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MRFFFLLHILLMLHHFISHLLIQRAACGAHIADQVLEIMPFFDQHTELLSIHSVGPWRIS
FLISSVFSFFFFSAAFIFSTFLKVASPPEATADQKSRLDMLVQKVLNVGIDSKAQIQERT
KEKVGKVMKETEEIKGKFMDIKKFTLADKRGKPIKEELEMEKKKRQMLLDEIKRLGEAKE
EMSNDDDEPFENLMKEIDKLFEEADENRKLQKEADKEIATAATRQDAVFNEEMEEIEKFL
SDIRNADKLQL
Download sequence
Identical sequences A8WM27
CBG25084 XP_002648697.1.8413 6238.CBG25084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]