SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8XK68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8XK68
Domain Number - Region: 36-105
Classification Level Classification E-value
Superfamily Neurophysin II 0.000863
Family Neurophysin II 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8XK68
Sequence length 105
Comment (tr|A8XK68|A8XK68_CAEBR) Protein CBG14557 {ECO:0000313|EMBL:CAP33042.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG14557 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MRSLPIHLLLVLIVSVGLVNACFLNSCPYRRYGRTIRCSSCGVENEGVCVAEEKCCTNEE
CFMTTECAYNSVCPELFCKIGIHPGYCMKKGYCCTQGGCQTSAMC
Download sequence
Identical sequences A8XK68
6238.CBG14557 XP_002644603.1.8413 CBG14557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]