SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9JKV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9JKV1
Domain Number - Region: 62-89
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0144
Family Pseudo ankyrin repeat 0.059
Further Details:      
 
Domain Number - Region: 111-278
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.0952
Family alpha-subunit of urease, catalytic domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9JKV1
Sequence length 357
Comment (tr|A9JKV1|A9JKV1_ASFPB) MGF 360-14L {ECO:0000313|EMBL:CAN10123.1} KW=Complete proteome OX=443876 OS=African swine fever virus (isolate Pig/Benin/Ben 97-1/1997) (ASFV). GN=MGF OC=Viruses; dsDNA viruses, no RNA stage; Asfarviridae; Asfivirus. OH=6937,9823,41426,85517,273792
Sequence
MLSLQTLAKKVVACNYLSSDYDYTLQRFGLWWDLGPIHLCNNCKQVFSYKHLQCFSEDDL
CLEAALVKAVKSDNLELIRLFVDWGANPEYGLIRVPAVYLKRLCAELGGLTPVSEPRLLE
ILKEVANLKSCAGVLLGYDMFCHNPLLETVTRTTLDTVTYTCSNIPLTGDTAHLLLTKFW
FALALRHNFTKAIHYFYKRHKNQLYWRVACSLYFNNIFDIHELCREKEICISPNLMMKFA
CLREKNYAAIYYCHRLGASLDYGMNLSIYNNNTLNMFFCIDLGAADFDRAQLIAHKAYMY
NLSNIFLVKQLFSRDVTLVLDVTEPQEIYDMLKTYTSKNMKRAEEYLTAHPEIIVID
Download sequence
Identical sequences A0A0A1DXU7 A9JKV1 D4I5L2
A9JKV1_ASFPB D4I5L2_ASF

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]