SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9KFL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9KFL3
Domain Number - Region: 45-147
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00536
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9KFL3
Sequence length 153
Comment (tr|A9KFL3|A9KFL3_COXBN) Uncharacterized protein {ECO:0000313|EMBL:ABS76637.2} KW=Complete proteome OX=434922 OS=Coxiella burnetii (strain Dugway 5J108-111). GN=CBUD_0925 OC=Coxiellaceae; Coxiella.
Sequence
MTVNKSLILLLDNRRICSFDVLKQGVVMMRRSSAESKETETMLAIVHDAVKQGDVPALKE
IDELGFPLEGEVYEKTDLPMVVAIKAKQFAVVNWLKKKGVNRVLFSGERNTQAADDFSIV
SALKILSAIFEIKDIKAIKAFLQGVNLNVYHYS
Download sequence
Identical sequences A9KFL3
WP_011996832.1.29693 WP_011996832.1.43615 WP_011996832.1.99156 434922.CBUD_0925 gi|209363923|ref|YP_001424307.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]