SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9KFR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9KFR4
Domain Number - Region: 319-392
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0418
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9KFR4
Sequence length 734
Comment (tr|A9KFR4|A9KFR4_COXBN) Uncharacterized protein {ECO:0000313|EMBL:ABS77953.1} KW=Complete proteome OX=434922 OS=Coxiella burnetii (strain Dugway 5J108-111). GN=CBUD_1299 OC=Coxiellaceae; Coxiella.
Sequence
MRRKKESSERLSKRNKVPVTLKELRARLSELEQWIAQEKKLVDFPNIWSFLEGKVEEGEW
EGVNGFWLMVYEGLRGKATLLEALAVYLEGPAKNDINASHLKASPRGEDREAGENVLCLI
ACAAGKRHPAMLNALVDQVKDLPSEDLLLLLKETAKGRNVAGVNTLWLIACAAVKGHPAM
LNALADRIKELSIEHLPLLLKETAQEAEGARRNTLWVIACAASHGHSAMLNALSDGVKKL
SAQDLLLLLKETAQAGGATGQNTLWEIACAAVNGHAAMLNALAGRIKELSKELSIEKLWL
LLKETAQAGGDAGRNTLWLIAWAAVKGHPAMLNALADRIKELSIENLLLLLEETAQAGDA
TGHNTLWLIAWAAVKGHPAMLNALVMHIKNLKPEEISDLLQKRPEGGVMAGENGLRLIVK
VAQSGHVEMLNAVAKKLMQLPRDKRSKLLTPEPENSTFEMLISVAARELKTQEFELLLPD
CFTDQFDLPASEDNYMQKIFPLMKEVNELISTPQASVESLEENEEPTVINPVDKQKLEFI
LDQVTQIETTKAKTNLLSFILFKLQHRINPTFMIKILVPLIRTEPKYSNNPQIKQLYLEN
KFSIITNIKNKRHEIESHLLDAFKVLKLGEESLDESLYSTLDHFIMQVFNYNQIGLDIDQ
AEKIRSHILAHCDQNVTALPYEIFTGMVITKAKDFLKTNSAPQRATRFGMFSLSGKQTEE
WLRDHDFSGEFELN
Download sequence
Identical sequences A9KFR4
WP_011997025.1.29693 WP_011997025.1.43615 WP_011997025.1.99156 gi|154707205|ref|YP_001424653.1| 434922.CBUD_1299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]