SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9KFY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9KFY5
Domain Number - Region: 75-139,183-207
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000222
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A9KFY5
Sequence length 461
Comment (tr|A9KFY5|A9KFY5_COXBN) Hypothetical cytosolic protein {ECO:0000313|EMBL:ABS76631.1} KW=Complete proteome OX=434922 OS=Coxiella burnetii (strain Dugway 5J108-111). GN=CBUD_0945 OC=Coxiellaceae; Coxiella.
Sequence
MRKVKTLYESALYHMSVLLLLNIFGKNCGKLSEGKLEELLNELNLPLRLKEAVRNSGEEL
TDYAEKYVVEFFSLILFRFCRSGNLEAVEYLFNVADSEIRRRLLISGDYQLLLEICTNQD
FAMLEKLWRLASGPVLEMLKNPDLWADVLRNPETTGAILQFIEKHKRLKNPINLAEIFFS
PVSSQGENLLTLAIKYNGKSAQHLIDFINRLWNTLDGKLLQKILCFSTHIGNALEAAFSY
EYKNPSSLIKSLLELYIAYRKKSKIRWGKLVKPTFLSELIHWAGKKTEFEETFEFFVKNI
PFSDYSVNEKLQKLLLDRIFVLLNSQILSLEEKGIIIKNYLSLILKFPEKWLTWEDASTV
EEKLNILLRAYENHLYERKENGENYLRQFLFFKGFSTQEKLVAVKKLKEALSSGLTDLKA
IKEVPALNNGRLGKLFKLYYSELSKSSCRISDCTVNYSVSG
Download sequence
Identical sequences A9KFY5
434922.CBUD_0945 gi|154705883|ref|YP_001424327.1| WP_011996844.1.29693 WP_011996844.1.43615 WP_011996844.1.99156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]