SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9KG20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9KG20
Domain Number - Region: 52-105
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00536
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9KG20
Sequence length 275
Comment (tr|A9KG20|A9KG20_COXBN) Segregation and condensation protein A {ECO:0000256|SAAS:SAAS00952062} KW=Complete proteome OX=434922 OS=Coxiella burnetii (strain Dugway 5J108-111). GN=CBUD_0981 OC=Coxiellaceae; Coxiella.
Sequence
MLTSILGRPMENQEVVNQLAGFEVKVSGQPLSKLPEDLYIPPDALRVFLEAFEGPLDLLL
YLIKKHNIDILDIPIAEITRQYMQFIDLMREMRIELAAEYLVMAAMLAEIKSRLLLPRPV
VEEENEQDPRAELVRRLQEYERYKKAAYDLDQLPRVGRDTFIADAAVPPMNTAKIHPTVE
LPELLNALKDVLQRASLYNAHSIAREPLSIRERMSRILSLVDKENFIAFTRLFTVEEGRM
GVVVTLIATLELIRQSVIELVQAEPFALIQIRAKG
Download sequence
Identical sequences A9KG20
WP_011996859.1.29693 WP_011996859.1.99156 434922.CBUD_0981 gi|209363937|ref|YP_001424362.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]