SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9T4Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9T4Q3
Domain Number - Region: 94-133
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00811
Family Major surface antigen p30, SAG1 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9T4Q3
Sequence length 138
Comment (tr|A9T4Q3|A9T4Q3_PHYPA) Predicted protein {ECO:0000313|EMBL:EDQ61598.1} KW=Complete proteome; Reference proteome OX=3218 OS=Physcomitrella patens subsp. patens (Moss). GN=PHYPADRAFT_88049 OC=Physcomitrella.
Sequence
MATAMARMAMAMASLSNPKSRLPALRPDNPHCVWRLLQSESKACFEVKCNSFILYSPKFK
EDFGDIHHVMFTLFRLNLNKRCPVKAVSSYAKYELVKLARYRNVFTLNCGLGQDLLPKSF
QNLCRTHRIGSGNDPKML
Download sequence
Identical sequences A9T4Q3
XP_001773560.1.60028 jgi|Phypa1_1|88049|fgenesh1_pg.scaffold_164000055 3218.JGI88049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]