SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9VNN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A9VNN2
Domain Number - Region: 360-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0183
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A9VNN2
Sequence length 488
Comment (sp|A9VNN2|Y3221_BACWK) UPF0061 protein BcerKBAB4_3221 {ECO:0000255|HAMAP-Rule:MF_00692} KW=Complete proteome OX=315730 OS=Bacillus weihenstephanensis (strain KBAB4). GN=BcerKBAB4_3221; OC=Bacillus cereus group.
Sequence
MTNKNETGWNLESSYTVLPKSFFTEIPPTPVHSPELIKLNNSLAISLGFNPEELKKDAEI
AILAGNTIPEGAHPLAQAYAGHQFGHFNVLGDGRALLIGEQITPSGERFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVSTGEPIYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLKALADYTIKRHYPEVESTENPYVALLQEVIKRQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDSYNQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENNWFLGIKKKLGLFSNEEHDQSLIE
KLLKAMEKYKADYTNTFRALTDNILENAPLFKSPEFKEWYELWQSRLERQKESKDDAYKL
MKNNNPVIIPRNHRVEEALEAAVKDGDYSVMEKLLQALANPYEYSQEQADYCTPPVPSNR
PYRTFCGT
Download sequence
Identical sequences A9VNN2
gi|163941141|ref|YP_001646025.1| 315730.BcerKBAB4_3221 WP_012261363.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]