SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9XIT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9XIT0
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 2.22e-19
Family Hydrophobin II, HfbII 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9XIT0
Sequence length 96
Comment (tr|A9XIT0|A9XIT0_9PEZI) Cerato-ulmin {ECO:0000313|EMBL:ABR15766.1} OX=108461 OS=Ophiostoma quercus. GN= OC=Ophiostoma.
Sequence
MQFSIATIALFLSAAMAAPYAGGGGAAPYEACSGLAGSPQCCATDVLGLADLDSPAALTS
GTQFTSTCVADGGRRPRCCVLPALGLALVCETPVGV
Download sequence
Identical sequences A9XIT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]