SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0ENR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0ENR4
Domain Number - Region: 7-58
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000667
Family Capz beta-1 subunit 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0ENR4
Sequence length 146
Comment (tr|B0ENR4|B0ENR4_ENTDS) Uncharacterized protein {ECO:0000313|EMBL:EDR23836.1} KW=Complete proteome OX=370354 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760). GN=EDI_117070 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MVDTDYKTWLQTNYEYQKFFFVKENEEIIVNILKMIKNFENYIFLTFNEYAIVISVDTPE
SEERTLKHYKDSIVLNYESVLSKWNLPGYSTKLRLAKVSFVEVRKELGVKETKLIGQTTD
TEHAQYEVKKITETKWKLIFAWKNVD
Download sequence
Identical sequences B0ENR4
gi|165896424|gb|EDR23836.1| gi|167391445|ref|XP_001739779.1| XP_001739779.1.18373 jCVI|EDI_117070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]