SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0G4H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0G4H1
Domain Number - Region: 5-45
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0199
Family EspA chaperone CesA 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0G4H1
Sequence length 55
Comment (tr|B0G4H1|B0G4H1_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EDR47623.1} KW=Complete proteome OX=411461 OS=Dorea formicigenerans ATCC 27755. GN=DORFOR_01158 OC=Dorea.
Sequence
MDKKEYDEIEEQANRLQSEAGRRCNQQIKEVNKYHEGYIQGVEDLLTTIRRGGVK
Download sequence
Identical sequences B0G4H1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]