SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0MTF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0MTF1
Domain Number - Region: 66-96
Classification Level Classification E-value
Superfamily Orange domain-like 0.00222
Family Hairy Orange domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0MTF1
Sequence length 124
Comment (tr|B0MTF1|B0MTF1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:EDS04603.1} KW=Complete proteome OX=445970 OS=Alistipes putredinis DSM 17216. GN=ALIPUT_00474 OC=Alistipes.
Sequence
MFSEKKNTYSFTELFNGNDSIQGCFDIAVAEQDAPADLVCADLAVVHPVGERHERDAQTV
GGFAPCEIFRVGFRMCGTELLQFVAQGLPDHLRKLIGSHAIQIDFLCHGLFDLTSQRKSF
IEAV
Download sequence
Identical sequences B0MTF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]