SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0R3L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0R3L9
Domain Number 1 Region: 10-58
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 1.26e-16
Family Nucleolar RNA-binding protein Nop10-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0R3L9
Sequence length 60
Comment (sp|B0R3L9|NOP10_HALS3) Ribosome biogenesis protein Nop10 {ECO:0000255|HAMAP-Rule:MF_00803} KW=Complete proteome OX=478009 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1). GN=OE_1817R; OC=Halobacteriaceae; Halobacterium.
Sequence
MKSDIRVCEAWRSHHDGPVYTLSETCPECGGDAVNSAPAPFDPADPHGKYRRALKERRRL
Download sequence
Identical sequences B0R3L9 Q9HRT9
gi|169235482|ref|YP_001688682.1| 478009.OE1817R 64091.VNG0548C gi|15789765|ref|NP_279589.1| WP_010902365.1.1784 WP_010902365.1.50382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]