SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0RHX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0RHX5
Domain Number - Region: 11-34
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0114
Family Preprotein translocase SecE subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0RHX5
Sequence length 41
Comment (tr|B0RHX5|B0RHX5_CLAMS) Putative membrane protein {ECO:0000313|EMBL:CAQ00234.1} KW=Complete proteome OX=31964 OS=20744 / JCM 9667 / LMG 2889 / C-1) (Corynebacterium sepedonicum). GN=CMS0110 OC=Clavibacter.
Sequence
MPLGPDGSNPKKPTTARYALWIIVGGIAVVMIGQGVYGILT
Download sequence
Identical sequences A0A067LJ00 A0A1Y3FGF1 A0A251YT02 A5CP92 B0RHX5 M5B765
gi|170780566|ref|YP_001708898.1| gi|148272034|ref|YP_001221595.1| gi|473832818|ref|YP_007685116.1| 31964.CMS_0110 443906.CMM_0855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]