SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1AKS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1AKS3
Domain Number - Region: 91-177
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00235
Family GABA-aminotransferase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1AKS3
Sequence length 215
Comment (tr|B1AKS3|B1AKS3_HUMAN) Serine palmitoyltransferase, long chain base subunit 2-like (Aminotransferase 2) {ECO:0000313|EMBL:CAI13236.1} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RP5-1077I2.1-002 OC=Catarrhini; Hominidae; Homo.
Sequence
NCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPLHVMVFTYMGYGIGTLFGYLRDFLRNWG
IEKCNAAVERKEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSAPGPLFDLMERVSDD
YNWTFRFTGRVIKDVINMGSYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGEFTS
SWQNALCVGGVLQADSVPQGPPWSWKMGRHSSLLE
Download sequence
Identical sequences B1AKS3
ENSP00000409125 ENSP00000409125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]