SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1CAT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1CAT8
Domain Number 1 Region: 48-104
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000206
Family Sigma4 domain 0.053
Further Details:      
 
Weak hits

Sequence:  B1CAT8
Domain Number - Region: 3-69
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.034
Family Multimerization domain of the phosphoprotein from sendai virus 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1CAT8
Sequence length 111
Comment (tr|B1CAT8|B1CAT8_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EDS71385.1} KW=Complete proteome; Reference proteome OX=445971 OS=Anaerofustis stercorihominis DSM 17244. GN=ANASTE_01084 OC=Anaerofustis.
Sequence
MAKSENYKIFERKLKDVNYKKKRLSLLEQLDSLDEEILTERDRISKELSFFERALDSLED
MDKNIIESNYLEKISMVKIAEETNYATSVCSRKKVKAVKNLMYLMTGIKED
Download sequence
Identical sequences B1CAT8
WP_007049855.1.2140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]