SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1IDS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1IDS1
Domain Number 1 Region: 1-84,168-260
Classification Level Classification E-value
Superfamily PHP domain-like 2.35e-43
Family PHP domain 0.0039
Further Details:      
 
Weak hits

Sequence:  B1IDS1
Domain Number - Region: 102-181
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0209
Family Pseudo ankyrin repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1IDS1
Sequence length 272
Comment (tr|B1IDS1|B1IDS1_CLOBK) PHP domain protein {ECO:0000313|EMBL:ACA46461.1} KW=Complete proteome OX=498213 OS=Clostridium botulinum (strain Okra / Type B1). GN=CLD_0101 OC=Clostridium.
Sequence
MIYADLHVHTNHSDGICEIANVLDMAKKKGIKAIAITDHDTVDQFDEISELGRKMDLEVV
KGVEMSCYDYDVFKKVHIVGLWLNENATHVKKLCDKTLKCRDNYHRDLIKELSEKGYDIT
YKDAKKYSKYSIVFKMNIFQALKEKYKDEMTKERYNELFASKTSKETDLKMGYTPVMNGI
EAIKKDGGIPIIAHPCQYDNYDQIEKYVKYGLQGIEINHSKMKKIDYKKTLDFAAKHNLA
KSGGSDFHDPDLIEFGCYGLTKEQYEELKHFR
Download sequence
Identical sequences B1IDS1
498213.CLD_0101 gi|170757413|ref|YP_001780294.1| WP_015958080.1.21789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]