SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1P2K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1P2K9
Domain Number - Region: 74-100
Classification Level Classification E-value
Superfamily Quinohemoprotein amine dehydrogenase C chain 0.00085
Family Quinohemoprotein amine dehydrogenase C chain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1P2K9
Sequence length 114
Comment (tr|B1P2K9|B1P2K9_CAEV) Surface envelope glycoprotein {ECO:0000313|EMBL:ABY53143.1} OX=254355 OS=Small ruminant lentivirus. GN=env OC=Lentivirus; Ovine/caprine lentivirus group.
Sequence
LGAYPDPEIEYRNMSQEVVREVYQEDWPWNTYPWPLWQMENVRQWLKENEKEYRNRKKNT
KEGIDDLLAGKIRGRFCVPHPFALLKCTKWCWYPAEIDEGSGRAEKIKINCIEV
Download sequence
Identical sequences B1P2K9 Q2VRM5
B1P2K9_9RETR Q2VRM5_9RETR

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]