SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2B2C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B2B2C8
Domain Number - Region: 190-241
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0353
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2B2C8
Sequence length 309
Comment (tr|B2B2C8|B2B2C8_PODAN) Podospora anserina S mat+ genomic DNA chromosome 6, supercontig 2 {ECO:0000313|EMBL:CAP71263.1} KW=Complete proteome; Reference proteome OX=515849 OS=(Pleurage anserina). GN=PODANS_6_3600 OC=Podospora.
Sequence
MPICIECRHPVKTLWREGGTSNTSSTTNKPSASGGHNIRLTVCKNCGRFCDKYVEHDFVV
LFIDLVLIKPQVYRHLLHNTLMNTPSADPSDPDHPKKEEDAFAPSIVRLGVLLLLFDVYL
TWARIERQSSDTEGLAERPIVTQYVFFLLLCTLTTLSFHLSIRFLTSSRFSPLPFLGMLP
RYPRPNSVSTALLVSSSTKLFPILMVIWEYDVPAAARSLGWAVVANNVEALKILLDCSYG
VAAFLAMAGALSRWAMGRVVLWAAGLEGVDSWTAGTEGGQIMGGDGRGLGELGVLLGYLK
DWAGRLAVG
Download sequence
Identical sequences B2B2C8
XP_001910129.1.27508 Pa_6_3600|chrm6_SC2|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]