SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2RRZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2RRZ7
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.88e-66
Family TRADD, N-terminal domain 0.000000451
Further Details:      
 
Domain Number 2 Region: 217-307
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000443
Family DEATH domain, DD 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2RRZ7
Sequence length 310
Comment (tr|B2RRZ7|B2RRZ7_MOUSE) TNFRSF1A-associated via death domain {ECO:0000313|EMBL:AAI38643.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_23521 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQ
ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGS
KFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPDGGLA
Download sequence
Identical sequences B2RRZ7 Q3U0V2
NP_001028333.1.92730 ENSMUSP00000034359 ENSMUSP00000034359 10090.ENSMUSP00000034359 ENSMUSP00000034359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]