SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2VLI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2VLI9
Domain Number 1 Region: 9-175,207-325
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.97e-73
Family WD40-repeat 0.0000835
Further Details:      
 
Domain Number 2 Region: 256-493
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 0.00000000000497
Family Prolyl oligopeptidase, N-terminal domain 0.059
Further Details:      
 
Weak hits

Sequence:  B2VLI9
Domain Number - Region: 610-708
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000497
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2VLI9
Sequence length 1223
Comment (tr|B2VLI9|B2VLI9_PODAN) Coatomer subunit alpha {ECO:0000256|PIRNR:PIRNR003354} KW=Complete proteome; Reference proteome OX=515849 OS=(Pleurage anserina). GN=PODANS_5_6300 OC=Podospora.
Sequence
MQSASGMLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLIDRFEEHDGPV
RGVDFHKTQPLFVSGGDDYKIKVWSYQTRRCLFTLNGHLDYIRTVFFHNELPWIVSASDD
QTIRIWNWQNRSLLCTMTGHNHYVMCAQFHPKDADLVVSASLDQTVRVWDISGLRKKHSA
PASIYESQMNQANQQQADMFGNTDAVVKFVLEGHDRGVNWVSFHPTMPLIVSAGDDRLIK
LWRMSETKAWEVDTCRGHFQNASGCLFHPHQDLILSAGEDKTIRVWDLNKRTAVHTFKRE
NDRFWVIAAHPEINLFAAGHDNGVMVFKLERERPASAVYQNQLFYITKEKHVKSYDLQKN
VESPTLLSLKKLGSPWVPPRTLSYNPAERSVLVTSPADGGSYELINLPRDGTGAIEPTES
KRGFGNSAIFVARNRFAVLNTAAQTIDIKDLQNNVTRSFKPPLGTSDIYFGGTGNLLIIT
PTAVHLYDVQQKKTTAELAVNGVKYVVWSNDGLYAALLSKHNVTIVTKTLEQVSTLHETI
RIKSATWDDAGVLLYSTLNHVKYTLLNGDNGIVRTLDQTVYLVRVKGRNVYCLDRAAKPR
ILQIDPTEYRFKLALVKRNYEEMLHIIQNSSLVGQSIISYLQKKGYPEIALQFVQDPTTR
FELAIECGNLEVAVEMAKQLDRPKLWTRLSAEALAHGNHSIVEMCYQKLKQFDKLSFLYL
TTGDEAKLTRMAKIAEHRGDFGSRFQNALYLGEVEDRIQMFKEIDLYPLAYATAKAHGLE
EECQSILEAAGLTEDELNLPTFGEPLTPPKPVVPTYKANWPTKATSQSFFEKALLGQMEG
LSLEDESAAVNGVDAEVQEDGAKRDLLGDADEEEEDAGGWDMGDDVVPEIEEGLTDVNIA
EAGGAGSSEADLWARNSPLAVDHAAGGSFESAMQLLNRQVGAVNFAPLKSRFLEVYQASK
TYLPASAGLPPLVNYVRRTVEEADLRKVLPVIPRDLEYLAEHDLHRGYKCMKTNKLEEGV
TIFKNILHSLLVNAVGSEDEVAEAKKVITAAAEYTLAMSIELERRSLGTPEAILANPELL
KRNLELAAYFTIPKIEVAHRQLALSNAMTQSMRSKNYSSALSFANRIISNGDAGGALAKL
LEAARRNKATCERNPHDAVEIEFDQFAEFEICAASYTPIYSGTSYEECAFDGSKYHTKYK
GTVCKVCEVCEVGKHGSGLKLFA
Download sequence
Identical sequences B2VLI9 Q86ZJ1
XP_001929805.1.27508 Pa_5_6300|chrm5_SC6|Putative

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]