SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2VX82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2VX82
Domain Number 1 Region: 94-232
Classification Level Classification E-value
Superfamily ISP domain 2.1e-38
Family Rieske iron-sulfur protein (ISP) 0.0000024
Further Details:      
 
Domain Number 2 Region: 51-106
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0000000000000019
Family ISP transmembrane anchor 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2VX82
Sequence length 233
Comment (tr|B2VX82|B2VX82_PYRTR) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome; Reference proteome OX=426418 OS=fungus) (Drechslera tritici-repentis). GN=PTRG_03128 OC=Pleosporaceae; Pyrenophora.
Sequence
MPALTNTARAVARSWTAHQLPVARAAGCTAMQTRNASASSFDSPFKGSPETTKIPSFAAY
RNKGGETGPKVFQYFMVGTMGALSALGAKATVQDFLVNMSASADVLAQAKVEIDLAAIPE
GKNVIIKWRGKPVFIRHRTEDEIKEADNTKWESLRDPQPDSDRVQKPEWLIMLGVCTHLG
CVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYDFPEEGKVVIG
Download sequence
Identical sequences B2VX82
XP_001933461.1.10593 PTRT_03128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]