SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2ZRH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2ZRH5
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 2.09e-31
Family T-antigen specific domain-like 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2ZRH5
Sequence length 87
Comment (tr|B2ZRH5|B2ZRH5_POVBK) Small T antigen {ECO:0000313|EMBL:ACD45604.1} OX=1891762 OS=BK polyomavirus (BKPyV) (Human polyomavirus 1). GN= OC=Viruses; dsDNA viruses, no RNA stage; Polyomaviridae. OH=9606
Sequence
FPLCPDTLYCKEWPICSKKPSVHCPCMLCQLRLRHLNRKFLRKEPLVWIDCYCIDCFTQW
FGLDLTEETLQWWVQIIGETPFRDLKL
Download sequence
Identical sequences B2ZRH5 B2ZRN0
B2ZRH5_POVBK B2ZRN0_POVBK

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]