SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3CTJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3CTJ7
Domain Number 1 Region: 7-50
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000536
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3CTJ7
Sequence length 51
Comment (tr|B3CTJ7|B3CTJ7_ORITI) Ankyrin repeat-containing protein 03_10 {ECO:0000313|EMBL:BAG40694.1} KW=Complete proteome OX=334380 OS=Orientia tsutsugamushi (strain Ikeda) (Rickettsia tsutsugamushi). GN=OTT_1236 OC=Rickettsiaceae; Rickettsieae; Orientia.
Sequence
MKALKFTLLFAVHIDGIDAKDDNGMTPIDYAAKSSNADVFNFLTEQSVPWY
Download sequence
Identical sequences B3CTJ7
334380.OTT_1236 gi|189184143|ref|YP_001937928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]