SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3L204 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B3L204
Domain Number - Region: 99-128
Classification Level Classification E-value
Superfamily PWI domain 0.0484
Family PWI domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3L204
Sequence length 143
Comment (tr|B3L204|B3L204_PLAKH) Uncharacterized protein {ECO:0000313|EMBL:CAQ38923.1} KW=Complete proteome; Reference proteome OX=5851 OS=Plasmodium knowlesi (strain H). GN=PKH_060850 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MDENISCSFGGGVSSGGSGSSDARLKRIEEEKKNFNGNNLNLLLADLKMMTAYEMSSEWN
DTKMMNECFNNFSWFDSRVLKNMQNYLSADEVERSKIDYAYNTLFPKPVDVKDTKMNMMS
LWIKSRIHYNNSFFPLQLSPYDA
Download sequence
Identical sequences A0A1A7VPW6 A0A1Y3DU67 B3L204
5850.PKH_060850 gi|193808220|emb|CAQ38923.1| gi|221054025|ref|XP_002261760.1| PKH_060850 XP_002261760.1.91479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]