SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3L6I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3L6I8
Domain Number 1 Region: 813-880,1134-1250
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-27
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 187-230,397-469
Classification Level Classification E-value
Superfamily SET domain 0.00000000409
Family Viral histone H3 Lysine 27 Methyltransferase 0.088
Further Details:      
 
Weak hits

Sequence:  B3L6I8
Domain Number - Region: 714-850
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000732
Family Pseudo ankyrin repeat 0.039
Further Details:      
 
Domain Number - Region: 58-115
Classification Level Classification E-value
Superfamily TPR-like 0.0171
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3L6I8
Sequence length 1512
Comment (tr|B3L6I8|B3L6I8_PLAKH) Uncharacterized protein {ECO:0000313|EMBL:CAQ40511.1} KW=Complete proteome; Reference proteome OX=5851 OS=Plasmodium knowlesi (strain H). GN=PKH_102480 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MLHVSLLRDVEKRVLRRRKERQTQKSNQQTQKDKQELRDIVIELPKLYERNDKEVISALV
TSYLDRNPKSILAYELFTKFYVKIGDYKSALNLLYAALYLDRKNENLASLLRFCEERQVS
KEARIPTKYKERICYAERRKEHALPVPSATELGDEESDDNDEISDRSKVESGKYSEERSA
KLSHDKRNQTKGHVTLAKRDMEPGEVVLQVKPLILTQHIFSNNYVYPTCYHCLRERSLSH
KCYQCPVNPHTCTHIFCSWKCLAQNMKVHMEECPLLPIISSAANEANLMIHLVLHIFRVL
IKLRIDKEYKDKEEHILKELFTNESFYQVVKENQVDIFNSFNTLANRIILEFPSSFYLHL
KQKELVEFMLIVWQYSLSVKYYSPSSIIKQANPETTFGLVFSPEITKLHHSCVPTCSFYY
GEDGVLTVRTICNIPQGGKLCISILSDQYIPLRVRKSCRSMARIFGCGCIRCADSTENNL
HLRSIKCPRCIVGYIYPMKTEALIEALNMEGGNALGKGKERGKVGKVDALDGAKQPDHGK
DTVKDIARKLEGDAERWLCSNCGKLTVQGNRRFIRLERNIYAQYQDAEKKYMQGDIIQAK
KKLLQIYNEVQYLLHPNHHILFNVYTLLAGLMKHDPKGQLYEALIFLRKAIIAAENVLPV
CSLEKVHLYAHLAHYTFDYSNHCKLYMKTGQIDAESVIEPIFASIWNAAVTTGYNSTLTI
TLIQQMRAYAILFNLYTPYNEIEFYINKKEEFTMFYHHVTQKKNESYRQIKKIMKEDPFY
PIYMACQCFNIDYGTQKYVSHIFKLFKHMQYVGNGQNALSIAASVGNVELVKVLLKLNYS
PFYKNELHMNALLHMASSFLPSEEQNHYSHYIPILLEEIQSQKVELDNFESDYARLLHGE
GAQKSGEGTKLMSMKDGHSNLHHWKNDLERPFPFENLLEDEEFIYGPDSRRLDNNQKIIL
TILLKHLDAKQMYKRRKYKEKVILNERINLAASGGRPMDVTNQPYEVNSEGELVLDPPPS
YIGSNNRKGKYDHEEDEKDEEGTEESILYTGIRTEYDTAGQRRRGDTLRSDKDIDSSKSD
DLKEKKKKFSLYHTRRKSNSEGSCTSPMCSTFDSGKSDDVLNNKVKHYYVQKILTKSISH
KLLGMNNALHYACIRGKRKLAKQLMVCGVPVKLMNSEGSTALHMASLSGQDEIVKNLLEY
QIEVDAMTFHGETPLMLGVYGLHLQVIKTLVENGAQVVLKNNDNVTVLHCLVQGILRTHT
IYYHHRAYNKNPSFVPVGGPFMERATSKGLSSERSYHLNAHIPIIEDLPSDLLLLPFKLL
HRIKKAITILKFLIMHCPLYLYEVKDINGYNPFQMLRASWRRVCEKRICMLANADLRLSA
FTHHQKNIIIQGWTLITALVNMLLSILRPDRSVLTSIYANFMGKQEITQMEECKGGENSR
TEEETSQQEVTTSPGVRSPPTNPPKEPTAQANPPGETKSTTSEKATTSEKATIVPKKMGP
KKAKMPPPPKKQ
Download sequence
Identical sequences A0A1A7VJ76 A0A1Y3DR73 B3L6I8
PKH_102480 5850.PKH_102480 XP_002259735.1.91479 gi|193809807|emb|CAQ40511.1| gi|221057195|ref|XP_002259735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]