SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3LY33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3LY33
Domain Number 1 Region: 11-64
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 78-121
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000196
Family Hairy Orange domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3LY33
Sequence length 180
Comment (tr|B3LY33|B3LY33_DROAN) Uncharacterized protein {ECO:0000313|EMBL:EDV42889.1} KW=Complete proteome; Reference proteome OX=7217 OS=Drosophila ananassae (Fruit fly). GN=Dana_GF16802 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEYTSKTQIYQKVKKPLLERQRRARINKCLDTLKTLVAELRGDDGILRMDKAEMLESAVI
FMRKQKIEKTEKVEEPKLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRIY
KNLQQFHEAQTANEIPAPIYMDCTTDKAPLSPASSGYHSDCDSPLPSPMPVEGEKLWRSW
Download sequence
Identical sequences B3LY33
XP_001954328.1.52611 FBpp0119994 7217.FBpp0119994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]