SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3NDE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3NDE2
Domain Number 1 Region: 50-151
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 9.15e-39
Family Chemosensory protein Csp2 0.00007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3NDE2
Sequence length 155
Comment (tr|B3NDE2|B3NDE2_DROER) Uncharacterized protein {ECO:0000313|EMBL:EDV52004.1} KW=Complete proteome OX=7220 OS=Drosophila erecta (Fruit fly). GN=Dere_GG15834 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGQPGFRRAIGHISLVVALMCTTCFQVEGLPHPPTTTPAPMMERMVEQAYDDKFDNVDLD
EILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAIQTDCTKCTEKQRYGAEKVTRHLI
DNRPTDWERLEKIYDPEGTYRIKYQEMKAKANAEP
Download sequence
Identical sequences B3NDE2
XP_001972978.1.56816 FBpp0134380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]