SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3S2V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3S2V5
Domain Number 1 Region: 7-32
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000381
Family Ran binding protein zinc finger-like 0.0038
Further Details:      
 
Weak hits

Sequence:  B3S2V5
Domain Number - Region: 74-99
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00408
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 
Domain Number - Region: 139-164
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0259
Family Ran binding protein zinc finger-like 0.0042
Further Details:      
 
Domain Number - Region: 287-318
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0405
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3S2V5
Sequence length 671
Comment (tr|B3S2V5|B3S2V5_TRIAD) Uncharacterized protein {ECO:0000313|EMBL:EDV22856.1} KW=Complete proteome; Reference proteome OX=10228 OS=Trichoplax adhaerens (Trichoplax reptans). GN=TRIADDRAFT_28239 OC=Eukaryota; Metazoa; Placozoa; Trichoplax.
Sequence
MSVNASTGSKWTCQVCTFDNHMSAVRCAMCYTNIEKAKESHGSAGCTQQSTLLITQYDNN
SKNAHQSNEYQRGSDQIWSCASCTYENCLNSSNCSMCEMQFYNDKNNERNHSNNPTSHGD
STSTNVDTGTNVINYKYCNKWICSRCTYENFIKSLRCVMCQNPRYPQEAQIDLNQLNIKS
KSPSVNQLTNHACNRGKPESCYITYSPTEEMIDNPYDTEVKIDNLHSYDAFPITEEDLNQ
IKNHLSTEDWSWLGACQGVKTGKRRPVEQYIASGGDVSRQLTNEDLMLLKWTNPVEIGYT
LVHLAIKYDHQDLLDILLTPVADRRAHKCLPSDAEPELAQDIREIVSMSIRQRKGEWPCY
FVTNIVTFALPAGIHSLSPDVQEQLFNEIIDRDVQNELEVNSTVINWSYEITEDLDSKLY
TLWNRTAGDCLLDSVMQVTWGVMDENAVLRRALRESLRCEDRFYQRWREAEAIQASILEF
SLDEQQCVKDWSNIIDSARKKGAPLEQIHIFVLAHIMRRPIIVYGVKYVNSYKGETLGLA
RFQGIYLPLLWERSFCVSNPVALAYTRGHFSAVVGIESDTVNDAVAGANVDNCENTQTIY
LPLIDSLSVPLPVHFLLNSELGCEEQLMHEWLDCECTSSGIIVAKQNITRMPFQVDRMLD
NWLDKYRKLDS
Download sequence
Identical sequences B3S2V5
10228.JGI28239 XP_002114722.1.101920 jgi|Triad1|28239|e_gw1.8.31.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]