SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3S397 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B3S397
Domain Number - Region: 329-406
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00889
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3S397
Sequence length 855
Comment (tr|B3S397|B3S397_TRIAD) Uncharacterized protein {ECO:0000313|EMBL:EDV22751.1} KW=Complete proteome; Reference proteome OX=10228 OS=Trichoplax adhaerens (Trichoplax reptans). GN=TRIADDRAFT_28218 OC=Eukaryota; Metazoa; Placozoa; Trichoplax.
Sequence
QYARVSHNSKPKDLLKLLIDHWKLPIPNLIISVTGGAKNFKLNQRDQEIFNRGLIKAGQS
TGAWILTGGTNIGVVKAVGRAIIESQSLAWVGKGTKREQLHCVGIAPWSYVDNCQSLINK
KENESIPKDYNVEPIVRRDCPVPLNPHHSYFLLVDDGTLRKYGGEIKLRGRLEKCIAEKN
CDDRLLDTVSKVSNTNKTILFLLCASHSGFGLGKPVVLLVLEGGLDCIKIVHEGISKRIP
AVVLEGTGRAADLIAFASKHATKMLVAYPKLKDQEDGKKDLQYHINLVKECIADEKLITI
FKLGEQKDQELDLAILSALLKAQCASKLDQLRLALNWDRADVAREKIFTEEVHWPPGSLD
EPMLTALIKNRVEFVKMFMENGVNMKDFLTMGKLSLIDIAFSLKDVGRLLKKLMGAHYEP
LYLRDRKFVDESIDHDVLISVSARLAGTNNYNLVEAATSNLGDETIVFDNPIHEMFLWAV
LSNRPEMAYFMWERGEESIAAALVGSKLFMAMASDNKIDSEKSAALIKDAKKFEELAISV
LEECYTQDEYLSQMLVKREMINWGGLNCLQMSGSADGERFISHPCCQSTLDEIWTNGIRS
STSMVPIATLLPFLIPLLISFEKQEDDDRYSGFCSSVFNDIKRFYQAPVTKYWGTVFWYI
IFLGLYSYVILFSFNAFPSIPEWILLGWIYTIAVELFRQVSMAPAAKYRRQQYMSRWTMV
AEVVSIFIAVIGFCLRWIPQAMEAARILYCLNGAIFYARVLRFYSFSISLGPKLVMIKRM
IMEVILFLYILVIFLVGYGVVSQALLYKNIPVTAENILQIIQRPYWQMYGELMLEKIEGN
SQNKPKVVRLCIITF
Download sequence
Identical sequences B3S397
XP_002114617.1.101920 jgi|Triad1|28218|e_gw1.8.187.1 10228.JGI28218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]