SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4GBW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B4GBW2
Domain Number - Region: 427-455
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0209
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4GBW2
Sequence length 1137
Comment (tr|B4GBW2|B4GBW2_DROPE) GL11015 {ECO:0000313|EMBL:EDW31341.1} KW=Complete proteome; Reference proteome OX=7234 OS=Drosophila persimilis (Fruit fly). GN=Dper_GL11015 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MFFQTNWVFHQPRSWIETNFQKRECIKFIPCPKDDTRCCCGQAQITHQTIQGIESGSPGD
LWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLL
ITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQRT
GRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKY
GAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCD
GSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQAEKLYQELLQCTRN
KNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYG
QEWPHGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYI
LRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSST
YQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALA
KSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLT
CELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLVMPLY
IRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGK
VSLTDSDPAQFREFFNLSEYNEIKQHQPLRLKKKFHEFYTAPITKFWADSIAYMFFLIMF
SFTVLVKMGPVPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGA
AIILFLIGLAFRFRPNTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNM
IYFVVLLAVVLMSFGVSRQAILYPNSEPTWRLIREVTYQPYFMLYGEVFADDIDPPCGED
PRQPACVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVM
EYQQKPVLPPPFIAFCHFYSLLKYCVRKAKGEPGMSKFSFVPCESIISECFIRLYNI
Download sequence
Identical sequences B4GBW2
XP_002015451.1.64850 7237.FBpp0277184 FBpp0175122 FBpp0277184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]